Friday!!!

(deactivated member)
on 4/24/08 8:41 pm - Terre Haute, IN
Hello all... how are you all doing? I hope you're well. I'm just out of bed, and still a little tired. I haven't been on writing too much lately, but I'm still around. Work's really getting on people for using non-work internet, so I can't go on from there anymore. Mikey's still down in Jeffersonville at Wellstone Hospital for residential treatment. I miss him so much. He will have an overnight pass on May 1st though, so that will be nice to get to spend some 'real' time with him. Mike, my dh, is still looking for work. I wish he'd find something soon. It's stressful on us all. The looking and waiting is the hardest part, I think. Maggie's fine as always. She's back in daycare so Mike can look for work, and she's enjoying that. She likes to play with the other kids.... our little social butterfly. She's already declared that at her birthday party in AUGUST, she wants friends there. Me? I'm tired from working so much. I dreamt about working last night! Argh. Alot of time I just want to curl up in a ball and hide. I think I'm going into a depressed phase again. I expect it to happen, the best thing I can do is take as good of care of myself as I can, so that it'll be not so bad. I'm still messing around with the same couple of pounds, but I look at it like this, really, on average, I haven't lost in the last 5 months, but I *have* maintained. That's pretty good. I can deal with that. So, come on down everyone, and tell us how your day is going or going to go :-)
LaChelle R.
on 4/24/08 8:52 pm - Erie, PA
Good morning all.  I hope you all have a wonderful day.  It is going to be nice, so get out and enjoy it.  I have to work, so that blows that idea out of the water for me.   Linda, I understand about the stressful situations that are going on right now.  Jimmy is in such a foul mood because he hasn't found a job yet either, and it is really putting a major strain on our marriage.  I do hope he finds something really soon.  I don't know how much more I can take.  Hope Mike finds something soon as well.  It makes life so much easier. The girls are fighting, so I need to go. Have a wonderful day.  Keep all of your loved ones in your thoughts and prayers. Everyone needs a quick prayer. Even me!
At Goal! 165 pounds gone forever! Thank you Lord!

You only have one life to live, but if lived right, it's the only one you need!
LaChelle R.
on 4/24/08 9:37 pm - Erie, PA
thmyonlinefriendsmakeeachdayspecial.jpg picture by kittikat22 Just had to share this with everyone!
At Goal! 165 pounds gone forever! Thank you Lord!

You only have one life to live, but if lived right, it's the only one you need!
Gail O.
on 4/25/08 3:55 am - indianapolis, IN
LaChelle, How CUTE !!!!!!!! and TRUTHFUL!!!!!!!!!!!!!!!! You always find the neatest things to post, Love ya Hugs & Blessings, Gail
Holly Knight
on 4/24/08 9:09 pm - New Waverly, IN
Good Morning all.....First night with DH in Talladega.....and I didn't sleep to bad.  My son had a terrible time getting to sleep though.....hope he is ok during school today. Today.....just started some laundry....and am sipping on my protein.....been very good this week about getting my calcium in also!!!!  Now to get my fluids up again..... Going to paint the section behind my stove.....pick up my rings in town, go to the Credit Union, and WalMArt to make a key.  Today is my carpool day for the Kindergarteners.....and taking the kids to play at McDonalds tonight.......after I get done here....I am off to the treadmill and then to shower. I hope everyone has a beautiful day...... Still plugging away for the Century Mark by May 2nd.....four pounds to go......AARRGH!!!!! Love and Hugs, Holly



 

SweetSherri
on 4/24/08 9:29 pm - Indianapolis, IN
Good morning everyone.............                   I survived the colonoscopy. Everything looked normal but Dr. Gupta took several biopsies. If they come back normal (next week), then she's sending me to a colleage of hers who is a gastroenterist. They've discussed my case history and he doesn't feel it's normal either but wanted her to go ahead with yesterday so that maybe some things could be ruled out with the biopsies. We stopped for a late lunch at Paradise Cafe on Meridian afterward (I really wanted their tomatoe soup!). By the time we got home, I had to rush to the bathroom..where I remained for most of the evening/night. It finally had slowed down this morning around 4 am. I called in to work. I have been having a hard enough time staying awake at the pc monitor at work WITH sleep. I might have gotten 2 hours last night so I knew better than to even try it. So..I took some tylenol for my headache (which I usually get with sleepless nights like last night) and I'm waiting for it to kick in...and then I'll try to again.                   Gail & Ellen...I'll give you ladies a call afterwhile.                    I hope everyone has a good Friday!             Sherri

 

  AT GOAL!!
http://www.myspace.com/sweetsherri61
Never allow someone to be your Priority while allowing yourself to be their Option......
Whenever God Closes One Door He Always Opens Another, Even Though Sometimes It's Hell in the Hallway...
rubens42
on 4/24/08 9:43 pm - Parker , CO

Hello everyone

 I can't believe my time has come. I am so very excited this has taken forever to finally get here. Move over everyone I am about to take a seat. 

 

See everyone on the flip side.

 

Robin 

Linda Kay
on 4/24/08 10:06 pm - Mooresville, IN
Best of luck sweetie hope it went wonderful for you!! Linda Kay
Annette C.
on 4/24/08 10:43 pm - Danville, IN
Good Friday Morning, Y'all! I'm so glad this week is almost over.  I am so tired.  I just want to get more than 5-6 hours of sleep.  It may not happen as we have the entire weekend planned.  But I can always hope. Linda, just add those hours spent dreaming about work to your time card.  You should get paid for it.  When I was in college I worked at JoAnn Fabrics and I would often dream that it was 99 cent calico day and I spent my entire night cutting fabric, 1/4 yard at a time. For those with temporarily unemployed husbands, you are in my prayers.  I've been there and done that.  It is a difficult situation for the whole family.  My DH was unemployed for a year.  Lord, have mercy, what a year that was. Sherri, Have they tested you for food allergies?  Following WLS, a new part of the intestine is now breaking down foods that used to be more thoroughly digested by the time they arrived there...maybe it's an allergic reaction of a sort. Hope everyone has a wonderful weekend!

Annette 
I can eat as much as I want...I just don't want much.
I'm ashamed of what I did for a Klondike bar...

Cindy P.
on 4/24/08 11:34 pm - Indianapolis, IN

Good Morning everyone!  It's supposed to be nice again today and then rain later (sometime tonight), so I hope everyone can enjoy the day.   Linda, I'm glad to hear that Mikey is progressing so well.  Just keep reminding yourself that you are doing the best thing for him, no matter how uncomfortable it makes you feel!  That's what a good mom does and you ARE a good mom.  I hope you begin to feel better soon and your husband can find a job soon too.   Lachelle, I hope your husband finds a job soon too.  I know when we decided it was time for my husband to go back to work (he stayed home with the kids after our daughter was born - he makes a much better househusband than I make a housewife!) it was because we were running into financial troubles now that both kids were in school (so many more expenses!) and it was a little strained there for a while. Sherri,  I hope the biopsies turn out OK, but I know that just leaves you still wondering what is causing all of your problems.  I hope they can figure it out soon and it turns out to be something easily treated/cured! 

To everyone else, I hope you have a great day.  I'm at work, but not much in the mood to be productive.  But I had better get my butt in gear!

Cindy

Most Active
Recent Topics
×